(data stored in ACNUC7421 zone)

EMBL: CP000667.PE260

CP000667.PE260       Location/Qualifiers
FT   CDS             complement(295932..296684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0260"
FT                   /product="LPXTG-motif cell wall anchor domain"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain; PFAM:
FT                   surface protein from Gram-positive cocci, anchor region"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52745"
FT                   /db_xref="GOA:A4X1J5"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J5"
FT                   /protein_id="ABP52745.1"
FT                   /translation="MRWKILAGALMALAFVIPATPAAAQVASPGLDESCQTVERKVYKD
FT                   IRELVTIDPDTAEYVKVRRLANQILSAANKHSFVATPPELQTAMSGSQDDLRAFLKTRI
FT                   EERWLTDLRIKIGKAMAADPDHTNVYEAAQEVLNTSSMDAHLAFLNDGLYAARELDCAA
FT                   QPTPTPSATATATPTPSTTVTASPTTPATDTPTPTPSTSLGTASGEGGGLPLTGANTAT
FT                   VAGIGGALLLLGGAGYLIGRRRRTRFLT"
     MRWKILAGAL MALAFVIPAT PAAAQVASPG LDESCQTVER KVYKDIRELV TIDPDTAEYV        60
     KVRRLANQIL SAANKHSFVA TPPELQTAMS GSQDDLRAFL KTRIEERWLT DLRIKIGKAM       120
     AADPDHTNVY EAAQEVLNTS SMDAHLAFLN DGLYAARELD CAAQPTPTPS ATATATPTPS       180
     TTVTASPTTP ATDTPTPTPS TSLGTASGEG GGLPLTGANT ATVAGIGGAL LLLGGAGYLI       240
     GRRRRTRFLT                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page