(data stored in ACNUC7421 zone)

EMBL: CP000667.PE261

CP000667.PE261       Location/Qualifiers
FT   CDS             complement(296813..297613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0261"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52746"
FT                   /db_xref="GOA:A4X1J6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J6"
FT                   /protein_id="ABP52746.1"
FT                   /translation="MFSRRTGDTRRPRCRTPPRGGAGAVTYRAGMQASPSDLTGRARLR
FT                   EAALRLFAERGFAATSARAVAAEAGLSPALVMHHFGSKEGLRAAVDEEVLARLGTALRE
FT                   LDPSGTDLMMSLGEVSARMFGADPVLRGYLRRVLQEDSPASAALFGRLLEGARAELERL
FT                   IATESGHTDADLEWAPFQMLCLIVGPLLLEPVMQPNLDRPMFDVQVLARRSVANQRLLR
FT                   LGLFGADPATAGDATDDLRAGAPDSATATRRAQPTVITDNEIPH"
     MFSRRTGDTR RPRCRTPPRG GAGAVTYRAG MQASPSDLTG RARLREAALR LFAERGFAAT        60
     SARAVAAEAG LSPALVMHHF GSKEGLRAAV DEEVLARLGT ALRELDPSGT DLMMSLGEVS       120
     ARMFGADPVL RGYLRRVLQE DSPASAALFG RLLEGARAEL ERLIATESGH TDADLEWAPF       180
     QMLCLIVGPL LLEPVMQPNL DRPMFDVQVL ARRSVANQRL LRLGLFGADP ATAGDATDDL       240
     RAGAPDSATA TRRAQPTVIT DNEIPH                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page