(data stored in ACNUC7421 zone)

EMBL: CP000667.PE265

CP000667.PE265       Location/Qualifiers
FT   CDS             301827..303512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0265"
FT                   /product="phenylacetic acid degradation protein paaN"
FT                   /note="TIGRFAM: phenylacetic acid degradation protein paaN;
FT                   PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52750"
FT                   /db_xref="GOA:A4X1K0"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1K0"
FT                   /protein_id="ABP52750.1"
FT                   /translation="MMADMTETPHPLYDRHADTLDRALTAISQRGYWSAYPESPSPRVY
FT                   GETAAGDGKVAFEAYLGRDFPLDQVGDGSTVRTEASPFGVDLGVGYPHATADHLTTAAS
FT                   TALPSWRDAGPQARAGVCLEILDRLHRNVFELANAVQFTSGQAFVMAFQAGGAHALDRA
FT                   LEALAYAYAEMTRHPGTAGWEKAAGKGDPLRMTKTFHVVPRGVALVIGCNTFPTWNSYP
FT                   GLFASLVTGNPVIVKPHPRAVLPLAVTVRYARQVLAEAGFDPNLVQLAPEAPGEKLAST
FT                   LAQHPAVRIVDFTGSSEYGDWLEANARQAQVYTEKAGLNAVVIDSTDDFGGMCRNLGFT
FT                   LTLYSGQMCTTSQNILIPRDGIETDQGHKSFAEVATGIATAVSKLTADPARGVELTGAI
FT                   VNDGVLERLDEVTKVGESVLESRTVTHPAFPGAVVRTPTIVRLNADDTATYTREWFGPI
FT                   SFVIGTDSTGHSLELLRATVGEKGALTAAVYSTDDAVLDAAETAAVEVGVHLSANLTGG
FT                   VFVNQSAAFSDFHGSGANAAANAALTDGAYVANRFRIVQSRRHV"
     MMADMTETPH PLYDRHADTL DRALTAISQR GYWSAYPESP SPRVYGETAA GDGKVAFEAY        60
     LGRDFPLDQV GDGSTVRTEA SPFGVDLGVG YPHATADHLT TAASTALPSW RDAGPQARAG       120
     VCLEILDRLH RNVFELANAV QFTSGQAFVM AFQAGGAHAL DRALEALAYA YAEMTRHPGT       180
     AGWEKAAGKG DPLRMTKTFH VVPRGVALVI GCNTFPTWNS YPGLFASLVT GNPVIVKPHP       240
     RAVLPLAVTV RYARQVLAEA GFDPNLVQLA PEAPGEKLAS TLAQHPAVRI VDFTGSSEYG       300
     DWLEANARQA QVYTEKAGLN AVVIDSTDDF GGMCRNLGFT LTLYSGQMCT TSQNILIPRD       360
     GIETDQGHKS FAEVATGIAT AVSKLTADPA RGVELTGAIV NDGVLERLDE VTKVGESVLE       420
     SRTVTHPAFP GAVVRTPTIV RLNADDTATY TREWFGPISF VIGTDSTGHS LELLRATVGE       480
     KGALTAAVYS TDDAVLDAAE TAAVEVGVHL SANLTGGVFV NQSAAFSDFH GSGANAAANA       540
     ALTDGAYVAN RFRIVQSRRH V                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page