(data stored in ACNUC7421 zone)

EMBL: CP000667.PE268

CP000667.PE268       Location/Qualifiers
FT   CDS             305397..305600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0268"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52753"
FT                   /db_xref="GOA:A4X1K3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1K3"
FT                   /protein_id="ABP52753.1"
FT                   /translation="MAQGTVKWFNAEKGYGFIAVDGGQDVFVHFSAIEMDGYKALDDGQ
FT                   RVEFEIAQGQKGPQAERVRVVA"
     MAQGTVKWFN AEKGYGFIAV DGGQDVFVHF SAIEMDGYKA LDDGQRVEFE IAQGQKGPQA        60
     ERVRVVA                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page