(data stored in ACNUC7421 zone)

EMBL: CP000667.PE276

CP000667.PE276       Location/Qualifiers
FT   CDS             317984..319492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0276"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52761"
FT                   /db_xref="GOA:A4X1L1"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L1"
FT                   /protein_id="ABP52761.1"
FT                   /translation="MWPAGQAGGDYADGMAETPPGAPPPSPTTAVPAAAPQMPSRRRNW
FT                   RRFLVLAGVILLIAACAVFMLWTLGESLGAEALLIGVFAAVLPVPVLVACFLWLDRYEP
FT                   EPLRYLVFCFAWGAFVATAVSLTVNTFAANRFEAAGLPTALTAVLVAPFIEELTKALGP
FT                   ILLLIFRRREISGITDALVYCGLSAIGFAMVENILYLGGIGYRTGVEEYGPATGTQQVI
FT                   AIFIFRILLFGFAHPLFTSMTAVGLGIAARSADRRVRVLAPAAGLLLAMMLHGAWNLLP
FT                   TLTQATGQLLIQLYGLIGVMVPIFFGMVALAVWLRSWEGRLTERTLPDYVRSGWLTPPE
FT                   VAALSSLGRRHAARVWAKRVGGDQGRKAMRGYQFAATRLALLRDGMRRGLDDRPAERER
FT                   AVAEERYLLELMSGYRAFFVGRDPRAPAGVWDGHRYHLRFPDGSQRAVAAPEEPVVPIP
FT                   VVLAPPSPPAFPPGYPPPPGYPPPPGHPPPGWYGPPTSGRPGQF"
     MWPAGQAGGD YADGMAETPP GAPPPSPTTA VPAAAPQMPS RRRNWRRFLV LAGVILLIAA        60
     CAVFMLWTLG ESLGAEALLI GVFAAVLPVP VLVACFLWLD RYEPEPLRYL VFCFAWGAFV       120
     ATAVSLTVNT FAANRFEAAG LPTALTAVLV APFIEELTKA LGPILLLIFR RREISGITDA       180
     LVYCGLSAIG FAMVENILYL GGIGYRTGVE EYGPATGTQQ VIAIFIFRIL LFGFAHPLFT       240
     SMTAVGLGIA ARSADRRVRV LAPAAGLLLA MMLHGAWNLL PTLTQATGQL LIQLYGLIGV       300
     MVPIFFGMVA LAVWLRSWEG RLTERTLPDY VRSGWLTPPE VAALSSLGRR HAARVWAKRV       360
     GGDQGRKAMR GYQFAATRLA LLRDGMRRGL DDRPAERERA VAEERYLLEL MSGYRAFFVG       420
     RDPRAPAGVW DGHRYHLRFP DGSQRAVAAP EEPVVPIPVV LAPPSPPAFP PGYPPPPGYP       480
     PPPGHPPPGW YGPPTSGRPG QF                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page