(data stored in ACNUC7421 zone)

EMBL: CP000667.PE279

CP000667.PE279       Location/Qualifiers
FT   CDS             320315..321586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0279"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52764"
FT                   /db_xref="GOA:A4X1L4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L4"
FT                   /protein_id="ABP52764.1"
FT                   /translation="MRERLRHAYQSVRSRRRSAGLRAGTPATASPASPRPAPAPPPPPA
FT                   VGTKTSAPLHSSTTSRDDADVPHALRVGAAWSWRLLAIGIVAWALLRVMGQVRIVIIPL
FT                   AIALLLSALLAPAVGWLLRARFPRSLATAVVLVGGLAAVIGTLTLVVNEFIQGLPVLGE
FT                   KSSQGVRQIQNWLRSGPLRLEDEQLDRYINDVEGWLNENIDGLTSGALSTAATVAEVLT
FT                   GTILVLFATFFFLRDGNRIWRFLVRLMPVNARWKVDDAGRASWQTLGAYVRATVLVACI
FT                   DALGIGIFLVIFEIPFALPLAALVFLASFIPIIGATLSGGVAVLVALVDSGPITALIIL
FT                   GVVIGVQQLEGHVLQPLIMGRAVAIHPLAVIVGIAAGVVLAGVTGALIAVPLIAVLNTA
FT                   VRRLAARTVPETPSDAVVVASRAP"
     MRERLRHAYQ SVRSRRRSAG LRAGTPATAS PASPRPAPAP PPPPAVGTKT SAPLHSSTTS        60
     RDDADVPHAL RVGAAWSWRL LAIGIVAWAL LRVMGQVRIV IIPLAIALLL SALLAPAVGW       120
     LLRARFPRSL ATAVVLVGGL AAVIGTLTLV VNEFIQGLPV LGEKSSQGVR QIQNWLRSGP       180
     LRLEDEQLDR YINDVEGWLN ENIDGLTSGA LSTAATVAEV LTGTILVLFA TFFFLRDGNR       240
     IWRFLVRLMP VNARWKVDDA GRASWQTLGA YVRATVLVAC IDALGIGIFL VIFEIPFALP       300
     LAALVFLASF IPIIGATLSG GVAVLVALVD SGPITALIIL GVVIGVQQLE GHVLQPLIMG       360
     RAVAIHPLAV IVGIAAGVVL AGVTGALIAV PLIAVLNTAV RRLAARTVPE TPSDAVVVAS       420
     RAP                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page