(data stored in ACNUC7421 zone)

EMBL: CP000667.PE287

CP000667.PE287       Location/Qualifiers
FT   CDS             329338..330285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0287"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52772"
FT                   /db_xref="GOA:A4X1M2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M2"
FT                   /protein_id="ABP52772.1"
FT                   /translation="MAISTSNAGSAAGSALRRGRRRPVDSTVKVLLVAAALVSVATTIG
FT                   IVIALVQPTIGFFQQVSIVEFVTGTSWTPTFAQKAYGVLPLVAATLTVTGVALAIAVPL
FT                   GLGSAIYLSEYANPRTRKVLKPIIELLAGVPTVVYGFVALFALNPLLQKWWPTDNGPAF
FT                   QNLLIAGIAMGIMIVPTIASISEDSMAAVPRSLREGAYALASTKMQVSTRVVVPAAMSG
FT                   IVAAVVLGISRAVGETMIVTIAGGLTSDRIVLNPLEGAATMTAFIANISSGDIPVGSLD
FT                   YDSVFAVGALLFLITFALNAVSIRMVRRFREVYE"
     MAISTSNAGS AAGSALRRGR RRPVDSTVKV LLVAAALVSV ATTIGIVIAL VQPTIGFFQQ        60
     VSIVEFVTGT SWTPTFAQKA YGVLPLVAAT LTVTGVALAI AVPLGLGSAI YLSEYANPRT       120
     RKVLKPIIEL LAGVPTVVYG FVALFALNPL LQKWWPTDNG PAFQNLLIAG IAMGIMIVPT       180
     IASISEDSMA AVPRSLREGA YALASTKMQV STRVVVPAAM SGIVAAVVLG ISRAVGETMI       240
     VTIAGGLTSD RIVLNPLEGA ATMTAFIANI SSGDIPVGSL DYDSVFAVGA LLFLITFALN       300
     AVSIRMVRRF REVYE                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page