(data stored in ACNUC7421 zone)

EMBL: CP000667.PE293

CP000667.PE293       Location/Qualifiers
FT   CDS             complement(335061..335780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0293"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52778"
FT                   /db_xref="GOA:A4X1M8"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M8"
FT                   /protein_id="ABP52778.1"
FT                   /translation="MIVEILLLVTAHAGEPSAVLPALDLLPHSVRTAPRDVRTLVAGPS
FT                   PDVVVIDARSELSEARDTCRMLHATGLNAPLIAVVTEAGLIALNADWGVDDVILASAGP
FT                   AEVEARLRLVIGRLADTTMGADSSIRAGELTIDTDTYAAKLKGRPLDLTYKEFELLKFL
FT                   AQHPGRVFTRDQLLREVWGYDYFGGTRTVDVHVRRLRAKLGSEYESMIGTVRQVGYKLV
FT                   VPPARALPESEPAPISV"
     MIVEILLLVT AHAGEPSAVL PALDLLPHSV RTAPRDVRTL VAGPSPDVVV IDARSELSEA        60
     RDTCRMLHAT GLNAPLIAVV TEAGLIALNA DWGVDDVILA SAGPAEVEAR LRLVIGRLAD       120
     TTMGADSSIR AGELTIDTDT YAAKLKGRPL DLTYKEFELL KFLAQHPGRV FTRDQLLREV       180
     WGYDYFGGTR TVDVHVRRLR AKLGSEYESM IGTVRQVGYK LVVPPARALP ESEPAPISV        239
//

If you have problems or comments...

PBIL Back to PBIL home page