(data stored in ACNUC7421 zone)

EMBL: CP000667.PE296

CP000667.PE296       Location/Qualifiers
FT   CDS             338241..339146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0296"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52781"
FT                   /db_xref="GOA:A4X1N1"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N1"
FT                   /protein_id="ABP52781.1"
FT                   /translation="MHHRLPRAGSPSILTRSDLMSRDSALVSADWAEKNLNTPGVVFVE
FT                   VDEDTSAYDTGHLPGAIKLDWKTDLQDQVRRDFVNKDQFAALLSERGIANGDTVVLYGG
FT                   NNNWFAAYAYWYFALYGHGDVRLLDGGRKKWELDARPLTTEAVSRPATQYVAQEPDHTI
FT                   RAFRDEVVAAIGTKNLVDVRSPDEYAGRLLAPAHLPQEQAQRAGHVPTAISVPWSKAAN
FT                   EDGTFKSDQELREIYAAAGLDDSRETIAYCRIGERSSHTWFVLQELLGHRNVKNYDGSW
FT                   TEYGSLVGVPVTLGDEPGKE"
     MHHRLPRAGS PSILTRSDLM SRDSALVSAD WAEKNLNTPG VVFVEVDEDT SAYDTGHLPG        60
     AIKLDWKTDL QDQVRRDFVN KDQFAALLSE RGIANGDTVV LYGGNNNWFA AYAYWYFALY       120
     GHGDVRLLDG GRKKWELDAR PLTTEAVSRP ATQYVAQEPD HTIRAFRDEV VAAIGTKNLV       180
     DVRSPDEYAG RLLAPAHLPQ EQAQRAGHVP TAISVPWSKA ANEDGTFKSD QELREIYAAA       240
     GLDDSRETIA YCRIGERSSH TWFVLQELLG HRNVKNYDGS WTEYGSLVGV PVTLGDEPGK       300
     E                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page