(data stored in ACNUC7421 zone)

EMBL: CP000667.PE3

CP000667.PE3         Location/Qualifiers
FT   CDS             3151..4284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52488"
FT                   /db_xref="GOA:A4X0T8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0T8"
FT                   /protein_id="ABP52488.1"
FT                   /translation="MKFRVERDALAEAVAWTAKSLPNRPSVPVLAGVLLRVTDGNLQVS
FT                   GFDYEVSSQVTVEVQGDADGATLVSGRLLAEITKALPAKPVDIAAVGAHLELVCGSARF
FT                   TLPTMPVEDYPTLPEMPVSAGTIDAAAFAAAVAQVAVAAGRDETLPMMTGVRLELSGGT
FT                   LAMLATDRYRLALREIEWNPEDPEISLNALVPARTLHDTAKALGPLGGQVTMALSQGAA
FT                   GEGMIGFVGGPRRTTSRLLDGANYPPVRSLFPATQNAQAQVPVSALIEVVKRVALVAER
FT                   TTPVLLSFSDDGLVVEAGGTEEARASEAMEATFSGDPLTIGFNPQYLIDGLSNMGTQFA
FT                   VLSFVDAFKPAVISPVGEDGEVVPGYRYLIMPIRVSR"
     MKFRVERDAL AEAVAWTAKS LPNRPSVPVL AGVLLRVTDG NLQVSGFDYE VSSQVTVEVQ        60
     GDADGATLVS GRLLAEITKA LPAKPVDIAA VGAHLELVCG SARFTLPTMP VEDYPTLPEM       120
     PVSAGTIDAA AFAAAVAQVA VAAGRDETLP MMTGVRLELS GGTLAMLATD RYRLALREIE       180
     WNPEDPEISL NALVPARTLH DTAKALGPLG GQVTMALSQG AAGEGMIGFV GGPRRTTSRL       240
     LDGANYPPVR SLFPATQNAQ AQVPVSALIE VVKRVALVAE RTTPVLLSFS DDGLVVEAGG       300
     TEEARASEAM EATFSGDPLT IGFNPQYLID GLSNMGTQFA VLSFVDAFKP AVISPVGEDG       360
     EVVPGYRYLI MPIRVSR                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page