(data stored in ACNUC7421 zone)

EMBL: CP000667.PE30

CP000667.PE30        Location/Qualifiers
FT   CDS             complement(37565..38266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0030"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52515"
FT                   /db_xref="GOA:A4X0W5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W5"
FT                   /protein_id="ABP52515.1"
FT                   /translation="MTERFRSAAHCEPFTVRVPNAVGQSRSRTNPPNPVHVHLPHNACS
FT                   VNSILSRYTYSNISLIKYWYDLRVDQSVLNDPRITAVGLLVEAHAGLSARFTAQFEQHG
FT                   LSPVEFEVLTRLVRSPDNRLRMTDLAAQTSLSTSGVTRVVDRMERDGLLTRRACPADRR
FT                   SSFAVATDSGCKRLDAVLPGHLRIIEEWFTGQLDPESLARLLDGLRRVRDAVHPGATAG
FT                   ATDPEPAPDSR"
     MTERFRSAAH CEPFTVRVPN AVGQSRSRTN PPNPVHVHLP HNACSVNSIL SRYTYSNISL        60
     IKYWYDLRVD QSVLNDPRIT AVGLLVEAHA GLSARFTAQF EQHGLSPVEF EVLTRLVRSP       120
     DNRLRMTDLA AQTSLSTSGV TRVVDRMERD GLLTRRACPA DRRSSFAVAT DSGCKRLDAV       180
     LPGHLRIIEE WFTGQLDPES LARLLDGLRR VRDAVHPGAT AGATDPEPAP DSR              233
//

If you have problems or comments...

PBIL Back to PBIL home page