(data stored in ACNUC7421 zone)

EMBL: CP000667.PE304

CP000667.PE304       Location/Qualifiers
FT   CDS             354824..355342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52789"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N9"
FT                   /protein_id="ABP52789.1"
FT                   /translation="MIVMNLDEKSFSFLELSKNVNYGRDALPSARDRQIRDLLLGAADS
FT                   ASLEQVKRLMPGDADRVLNAFAERAASIAVRHQDARELRAGILAAAIAQAITGDLRESL
FT                   AALSLLYRASEMIGHDPNSEFAAANDLSGGRAIGLLDFLRRSPEDKTIQAMGYEEGDDK
FT                   GGFRFVRNW"
     MIVMNLDEKS FSFLELSKNV NYGRDALPSA RDRQIRDLLL GAADSASLEQ VKRLMPGDAD        60
     RVLNAFAERA ASIAVRHQDA RELRAGILAA AIAQAITGDL RESLAALSLL YRASEMIGHD       120
     PNSEFAAAND LSGGRAIGLL DFLRRSPEDK TIQAMGYEEG DDKGGFRFVR NW               172
//

If you have problems or comments...

PBIL Back to PBIL home page