(data stored in ACNUC7421 zone)

EMBL: CP000667.PE308

CP000667.PE308       Location/Qualifiers
FT   CDS             361647..362435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0308"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52793"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1P3"
FT                   /protein_id="ABP52793.1"
FT                   /translation="MTSEDLQFTVLGCATPYPSVDNPCSGYLVTGGGARVWVDAGSGTL
FT                   AQLQRHVRLDELDAIWISHLHADHSADLLTAYYGALYADIQLAAPIPLYGPPGIADRLA
FT                   HFLTNTATRSPIESAFAVEELHDGHRVEVGALTLTSQAVAHGIPAFALRVDNAGRSLVY
FT                   SGDTAPCPGLTSLARGCDVLLCEAESAQAPSAGEQVHHTPEDAGDTARLAEARRLIVTH
FT                   IGRFLTPQQAVTRASTRFDGPIDHAAPGATHPVDRVVTPR"
     MTSEDLQFTV LGCATPYPSV DNPCSGYLVT GGGARVWVDA GSGTLAQLQR HVRLDELDAI        60
     WISHLHADHS ADLLTAYYGA LYADIQLAAP IPLYGPPGIA DRLAHFLTNT ATRSPIESAF       120
     AVEELHDGHR VEVGALTLTS QAVAHGIPAF ALRVDNAGRS LVYSGDTAPC PGLTSLARGC       180
     DVLLCEAESA QAPSAGEQVH HTPEDAGDTA RLAEARRLIV THIGRFLTPQ QAVTRASTRF       240
     DGPIDHAAPG ATHPVDRVVT PR                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page