(data stored in ACNUC7421 zone)

EMBL: CP000667.PE31

CP000667.PE31        Location/Qualifiers
FT   CDS             38287..39765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52516"
FT                   /db_xref="GOA:A4X0W6"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W6"
FT                   /protein_id="ABP52516.1"
FT                   /translation="MGRDVTRGAFSREDRVRYRRKVRRCLDVFALMLDDFGFDADRPMT
FT                   GLEIELNLVDSAAEPAMRNEEILADIADPLFQTELGQFNLELNAAPRLIEGTGFTGYEQ
FT                   DLRGSLARADEWAARSDAKILLVGILPTLTEGHLVVDNLSANERYRALNDQIVGARGED
FT                   IELDIRGVERLQTHTDSIAPESACTSLQFHLQVSPDSFADYWNASQAIAAAQVATGANS
FT                   PYLYGRQLWAETRIALFQQATDTRPDELKAQGVRPRVWFGERWITSIFDLFEENVRYFP
FT                   PLLPICEEEDPVEVLHAGGVPKLGELRLHNGTVYRWNRPVYDITEGRPHLRVENRVLPA
FT                   GPTVIDMLANAAFYFGSARGLAEADRPTWSQLPFSSAEENFHSAARRGMDAVVYWPRLG
FT                   EVPVAELVLDVLLPQAATGLDRFGVAPGERDRLLGVIEQRCRTRRNGAVWQAETVWAAE
FT                   RHRKLDRPAALHHMVQRYAELQRSNEPVHTWPVE"
     MGRDVTRGAF SREDRVRYRR KVRRCLDVFA LMLDDFGFDA DRPMTGLEIE LNLVDSAAEP        60
     AMRNEEILAD IADPLFQTEL GQFNLELNAA PRLIEGTGFT GYEQDLRGSL ARADEWAARS       120
     DAKILLVGIL PTLTEGHLVV DNLSANERYR ALNDQIVGAR GEDIELDIRG VERLQTHTDS       180
     IAPESACTSL QFHLQVSPDS FADYWNASQA IAAAQVATGA NSPYLYGRQL WAETRIALFQ       240
     QATDTRPDEL KAQGVRPRVW FGERWITSIF DLFEENVRYF PPLLPICEEE DPVEVLHAGG       300
     VPKLGELRLH NGTVYRWNRP VYDITEGRPH LRVENRVLPA GPTVIDMLAN AAFYFGSARG       360
     LAEADRPTWS QLPFSSAEEN FHSAARRGMD AVVYWPRLGE VPVAELVLDV LLPQAATGLD       420
     RFGVAPGERD RLLGVIEQRC RTRRNGAVWQ AETVWAAERH RKLDRPAALH HMVQRYAELQ       480
     RSNEPVHTWP VE                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page