(data stored in ACNUC7421 zone)

EMBL: CP000667.PE317

CP000667.PE317       Location/Qualifiers
FT   CDS             368998..369576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52802"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q2"
FT                   /protein_id="ABP52802.1"
FT                   /translation="MTSQPKTSRIPAPLYAAAGAGDLAYQQLRKLPAVVSELRDRVAAD
FT                   LSTVNGAELRQKATETLRTATVTAENLRRRAATDLDLSRLRETATRNAAVVVASAQAAQ
FT                   ERAATTYGALVGHGERVVGAGVLEAADTVNTDMETTEKAPAPTPAQVAEAAEAKPAAVT
FT                   KRATKATGKPATSSTKSPRATKRTPPAGD"
     MTSQPKTSRI PAPLYAAAGA GDLAYQQLRK LPAVVSELRD RVAADLSTVN GAELRQKATE        60
     TLRTATVTAE NLRRRAATDL DLSRLRETAT RNAAVVVASA QAAQERAATT YGALVGHGER       120
     VVGAGVLEAA DTVNTDMETT EKAPAPTPAQ VAEAAEAKPA AVTKRATKAT GKPATSSTKS       180
     PRATKRTPPA GD                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page