(data stored in ACNUC7421 zone)

EMBL: CP000667.PE320

CP000667.PE320       Location/Qualifiers
FT   CDS             complement(371005..372090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0320"
FT                   /product="Polymorphic membrane protein, Chlamydia"
FT                   /note="PFAM: Polymorphic membrane protein, Chlamydia"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52805"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q5"
FT                   /protein_id="ABP52805.1"
FT                   /translation="MPCDADALIAAITLANARDGAVLDLARDCTYLLTADIDGNGLPVI
FT                   TAPITLNGNKNTTIERAANADEFRILTVDTGGNLTLDHLTITGGQTTSAGGGILVNPGG
FT                   TLTTNRSTVTRNIADSNGGGIVNNGTTRIISSTISHNTADGPGGGIYSLGVIDVKKSHV
FT                   NANTTTTAGAGVMSFGTARIEHSTVTANHAQGTIGGLFISGTGTVTDSKFSKNTALEAA
FT                   GVVMNFDTQLTLKAVTIIENIATQGRAGGLATSDNSSVVVEGGAITNNAATTDGGGIYN
FT                   FADLVLRDTRINGNQADQGAGIYNEETVILFDTKVVKNVAITDGGGIVNDGGTVELNTA
FT                   TGTIVIKNRPNNCVDVPGCAG"
     MPCDADALIA AITLANARDG AVLDLARDCT YLLTADIDGN GLPVITAPIT LNGNKNTTIE        60
     RAANADEFRI LTVDTGGNLT LDHLTITGGQ TTSAGGGILV NPGGTLTTNR STVTRNIADS       120
     NGGGIVNNGT TRIISSTISH NTADGPGGGI YSLGVIDVKK SHVNANTTTT AGAGVMSFGT       180
     ARIEHSTVTA NHAQGTIGGL FISGTGTVTD SKFSKNTALE AAGVVMNFDT QLTLKAVTII       240
     ENIATQGRAG GLATSDNSSV VVEGGAITNN AATTDGGGIY NFADLVLRDT RINGNQADQG       300
     AGIYNEETVI LFDTKVVKNV AITDGGGIVN DGGTVELNTA TGTIVIKNRP NNCVDVPGCA       360
     G                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page