(data stored in ACNUC7421 zone)

EMBL: CP000667.PE327

CP000667.PE327       Location/Qualifiers
FT   CDS             complement(379049..379810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0327"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52812"
FT                   /db_xref="GOA:A4X1R2"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R2"
FT                   /protein_id="ABP52812.1"
FT                   /translation="MNKLHGTKDFWIGALRVEGPAFAAAIAEAPADTPVLSCPGWTVTD
FT                   LTRHLASVYRWVHGNVSTNTVTPPSLHSELVEPNPGETDLQLWQQAYDELMVRFDALDP
FT                   EAPAWNWAPQPKKAGFWPRRIAHETALHRWDAQLSIGAGDPIETKLAADGVSEVLDTCL
FT                   PAGRRPDHGQWHGVVHLSASDAGQEWFLRLRGDGVALLDTDTIFDDHDHHARVQVVGTA
FT                   SDLLLALWGRVSFDTLAVTGERALLAGLRTG"
     MNKLHGTKDF WIGALRVEGP AFAAAIAEAP ADTPVLSCPG WTVTDLTRHL ASVYRWVHGN        60
     VSTNTVTPPS LHSELVEPNP GETDLQLWQQ AYDELMVRFD ALDPEAPAWN WAPQPKKAGF       120
     WPRRIAHETA LHRWDAQLSI GAGDPIETKL AADGVSEVLD TCLPAGRRPD HGQWHGVVHL       180
     SASDAGQEWF LRLRGDGVAL LDTDTIFDDH DHHARVQVVG TASDLLLALW GRVSFDTLAV       240
     TGERALLAGL RTG                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page