(data stored in ACNUC7421 zone)

EMBL: CP000667.PE33

CP000667.PE33        Location/Qualifiers
FT   CDS             41282..42034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0033"
FT                   /product="PASTA domain containing protein"
FT                   /note="PFAM: PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52518"
FT                   /db_xref="GOA:A4X0W8"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W8"
FT                   /protein_id="ABP52518.1"
FT                   /translation="MSSGSEGGRGMSDDRKPAADGPDDETRPLPAEQTGPRPPGDQTVP
FT                   LPPTGGPGPWSGRAGVPPPRPPEYQEATGWYAEPNGRRWWSPIFWGVVVLLLAVFGAGL
FT                   WLALAGDDEQLVPESSPSATTPQASPTRTSATPTSPTRTSATPTSATPTSTEPPTPSVT
FT                   EEPGEVPMPPVVNLPLTTAQAILDEAGLAYRIQFRTSDRPSGTVIGTTPRAGVLVPEGT
FT                   AVVLVVSRSGPSPERSTPTPSPEPTPTS"
     MSSGSEGGRG MSDDRKPAAD GPDDETRPLP AEQTGPRPPG DQTVPLPPTG GPGPWSGRAG        60
     VPPPRPPEYQ EATGWYAEPN GRRWWSPIFW GVVVLLLAVF GAGLWLALAG DDEQLVPESS       120
     PSATTPQASP TRTSATPTSP TRTSATPTSA TPTSTEPPTP SVTEEPGEVP MPPVVNLPLT       180
     TAQAILDEAG LAYRIQFRTS DRPSGTVIGT TPRAGVLVPE GTAVVLVVSR SGPSPERSTP       240
     TPSPEPTPTS                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page