(data stored in ACNUC7421 zone)

EMBL: CP000667.PE333

CP000667.PE333       Location/Qualifiers
FT   CDS             384799..385461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52818"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R8"
FT                   /protein_id="ABP52818.1"
FT                   /translation="MAQRSSAGRGGTATRTGRGAGNQTQGTPQVSEATISRMRVDEIRG
FT                   QLRQHGVSGTSALRKPELVRTLVKTLRAERRSSGAKGPGRRAASSGRSAGGTAVRTGPR
FT                   TSRSVRSSQVIAAPTDRPERPGRSLVTTNHEVIRRWARQRNAKPATIRGTERDGRAGVL
FT                   TFNMPGYRESSRVREITWVEWFRTFDLRKLNLIYQERLRDGRISNFFRTESPDREDG"
     MAQRSSAGRG GTATRTGRGA GNQTQGTPQV SEATISRMRV DEIRGQLRQH GVSGTSALRK        60
     PELVRTLVKT LRAERRSSGA KGPGRRAASS GRSAGGTAVR TGPRTSRSVR SSQVIAAPTD       120
     RPERPGRSLV TTNHEVIRRW ARQRNAKPAT IRGTERDGRA GVLTFNMPGY RESSRVREIT       180
     WVEWFRTFDL RKLNLIYQER LRDGRISNFF RTESPDREDG                             220
//

If you have problems or comments...

PBIL Back to PBIL home page