(data stored in ACNUC7421 zone)

EMBL: CP000667.PE336

CP000667.PE336       Location/Qualifiers
FT   CDS             388340..389572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0336"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52821"
FT                   /db_xref="GOA:A4X1S1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S1"
FT                   /protein_id="ABP52821.1"
FT                   /translation="MLLAWLVLTRRAGSTLMGSHQSGSPRPRGRPAIADGPQSGLGRRT
FT                   IDSLRVGVVVLADDDGPVLVNPAARAMGLLRAGGAPGTVTAHPLIRTLAGQVRRTGVRR
FT                   EIQLDLPRGDDSVAAENPLGVHLRAVGLGGGHVAVEAVDVTESHRLARVRRDFVANVSH
FT                   ELKTPIGALQLLAEALLDATEPADEEQPDLSEDLVATRRFAERIRHESTRLGRLVQELL
FT                   ELTRLQGADPQPAPEPVAVDWVVGEVVDRTRTGASARRIDVVVDGERGLTVYGSDTQLA
FT                   TAVSNLVENAINYSGEDTTVRITARHDDEHVTIAVTDQGIGIGPREVDRIFERFYRADQ
FT                   ARSRATGGTGLGLAIVKHIASNHGGRVEVASTPDEGSTFTLRLPARAPDDPLVIPPSAE
FT                   IEAEPAESQQT"
     MLLAWLVLTR RAGSTLMGSH QSGSPRPRGR PAIADGPQSG LGRRTIDSLR VGVVVLADDD        60
     GPVLVNPAAR AMGLLRAGGA PGTVTAHPLI RTLAGQVRRT GVRREIQLDL PRGDDSVAAE       120
     NPLGVHLRAV GLGGGHVAVE AVDVTESHRL ARVRRDFVAN VSHELKTPIG ALQLLAEALL       180
     DATEPADEEQ PDLSEDLVAT RRFAERIRHE STRLGRLVQE LLELTRLQGA DPQPAPEPVA       240
     VDWVVGEVVD RTRTGASARR IDVVVDGERG LTVYGSDTQL ATAVSNLVEN AINYSGEDTT       300
     VRITARHDDE HVTIAVTDQG IGIGPREVDR IFERFYRADQ ARSRATGGTG LGLAIVKHIA       360
     SNHGGRVEVA STPDEGSTFT LRLPARAPDD PLVIPPSAEI EAEPAESQQT                  410
//

If you have problems or comments...

PBIL Back to PBIL home page