(data stored in ACNUC7421 zone)

EMBL: CP000667.PE340

CP000667.PE340       Location/Qualifiers
FT   CDS             392238..393146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0340"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52825"
FT                   /db_xref="GOA:A4X1S5"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S5"
FT                   /protein_id="ABP52825.1"
FT                   /translation="MPATLDAVPRVPVLLSTSSVFPERTAAAFQLAATLGYDGVEVMVW
FT                   TDAVSQDAGALAGLAKHYGVPVLSVHAPCLLVTQRVWSADPWERLRRSGQLAEALGAPT
FT                   VVVHPPFTWQRDYARNFAEGLDEVTGQFGGISFPVENMYPVRMAGRQFVPYAPGWDPTT
FT                   TGYPSYTLDLSHCAASHTDALELADRMGAGLTHVHLGDGTGEGRDEHLVPGRGTQPCAE
FT                   LLRSLAGRGFTGSVAVEVSTRRAKSRAVREADLRAALAFARQHLDPPAAATNAGPDPVR
FT                   RGGREAEELDSGAPRRPPAFS"
     MPATLDAVPR VPVLLSTSSV FPERTAAAFQ LAATLGYDGV EVMVWTDAVS QDAGALAGLA        60
     KHYGVPVLSV HAPCLLVTQR VWSADPWERL RRSGQLAEAL GAPTVVVHPP FTWQRDYARN       120
     FAEGLDEVTG QFGGISFPVE NMYPVRMAGR QFVPYAPGWD PTTTGYPSYT LDLSHCAASH       180
     TDALELADRM GAGLTHVHLG DGTGEGRDEH LVPGRGTQPC AELLRSLAGR GFTGSVAVEV       240
     STRRAKSRAV READLRAALA FARQHLDPPA AATNAGPDPV RRGGREAEEL DSGAPRRPPA       300
     FS                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page