(data stored in ACNUC7421 zone)

EMBL: CP000667.PE352

CP000667.PE352       Location/Qualifiers
FT   CDS             403218..403865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0352"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52837"
FT                   /db_xref="GOA:A4X1T7"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T7"
FT                   /protein_id="ABP52837.1"
FT                   /translation="MSSAHPHLVWDWNGTLLNDLDLVVASTNVAFASVGGPAVTADEHR
FT                   VRFRRPIADYYAEVLGQAVDETAFGQLDKLFHEVYKDGLTTCALAHDAVDAMSSWPGSQ
FT                   SLLSMWFHEDLVPTVQTYGLTKNFLRVDGLRAEIGGDRKAESLARHLAELRLDGRDVVL
FT                   IGDSLDDADAARSVGGRAVLYAGGFTDAARLRASGHPVAETLTEAVALAHPH"
     MSSAHPHLVW DWNGTLLNDL DLVVASTNVA FASVGGPAVT ADEHRVRFRR PIADYYAEVL        60
     GQAVDETAFG QLDKLFHEVY KDGLTTCALA HDAVDAMSSW PGSQSLLSMW FHEDLVPTVQ       120
     TYGLTKNFLR VDGLRAEIGG DRKAESLARH LAELRLDGRD VVLIGDSLDD ADAARSVGGR       180
     AVLYAGGFTD AARLRASGHP VAETLTEAVA LAHPH                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page