(data stored in ACNUC7421 zone)

EMBL: CP000667.PE353

CP000667.PE353       Location/Qualifiers
FT   CDS             complement(403935..404576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0353"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52838"
FT                   /db_xref="GOA:A4X1T8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T8"
FT                   /protein_id="ABP52838.1"
FT                   /translation="MRIVIADDAVLLREGLIRLLTERGHQVVAAVGDGAALVQAVVTHR
FT                   PDLSIVDVRMPPSHTDEGLRAAVEARALAPAAPILVLSQYVEVSYADDLLATGVGVGYL
FT                   LKDRVAAIDEFLAALDRVAAGGTVLDPEVITQLFARRRRDDPLRALTPREREVLSLMAE
FT                   GHSNTAIARTLVVTDGAVEKHVRNIFTKLNLPPDVEQHRRVRAVLTYLRG"
     MRIVIADDAV LLREGLIRLL TERGHQVVAA VGDGAALVQA VVTHRPDLSI VDVRMPPSHT        60
     DEGLRAAVEA RALAPAAPIL VLSQYVEVSY ADDLLATGVG VGYLLKDRVA AIDEFLAALD       120
     RVAAGGTVLD PEVITQLFAR RRRDDPLRAL TPREREVLSL MAEGHSNTAI ARTLVVTDGA       180
     VEKHVRNIFT KLNLPPDVEQ HRRVRAVLTY LRG                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page