(data stored in ACNUC7421 zone)

EMBL: CP000667.PE362

CP000667.PE362       Location/Qualifiers
FT   CDS             complement(416668..417945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0362"
FT                   /product="Membrane-bound lytic murein transglycosylase
FT                   B-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52847"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1U7"
FT                   /protein_id="ABP52847.1"
FT                   /translation="MVDGEENQTLRPLRPATPGGGAQSGSGVAAGQRPGRVPRPRRPWL
FT                   RPPTAPDVEPTRAPDAATTDDPKSDLSTAADPTAADPTAARARVDTTVATADSDEPSHT
FT                   DADPVDEPSGSGDPAGPERAARAQRRRTRFAHAIRVTPTRLAVNAARSVHRWSRRPSGQ
FT                   LTVPGGFLLLLVTATVAAGALLLPATVRSDPDTTVASPGTTAAPTSAPDGAAPAGTLPP
FT                   PDPTMTGPTPGLGRPADTLASWAAQTGPKVGIAPVALQAYGYAELVLAQTNRSCGLSWT
FT                   TLAAIGHVESAHGQANNAQLGPDGRAAPEIIGLPLDGQGGRMLIRDTDRGTLDQDATYD
FT                   RAIGPMQFIPTTWQEIGADADSDGRKDPHDIDDAALAAANYLCKGGRNLTVAGDWWNAI
FT                   LSYNNVRQYAQDVFDKANQYGQASRT"
     MVDGEENQTL RPLRPATPGG GAQSGSGVAA GQRPGRVPRP RRPWLRPPTA PDVEPTRAPD        60
     AATTDDPKSD LSTAADPTAA DPTAARARVD TTVATADSDE PSHTDADPVD EPSGSGDPAG       120
     PERAARAQRR RTRFAHAIRV TPTRLAVNAA RSVHRWSRRP SGQLTVPGGF LLLLVTATVA       180
     AGALLLPATV RSDPDTTVAS PGTTAAPTSA PDGAAPAGTL PPPDPTMTGP TPGLGRPADT       240
     LASWAAQTGP KVGIAPVALQ AYGYAELVLA QTNRSCGLSW TTLAAIGHVE SAHGQANNAQ       300
     LGPDGRAAPE IIGLPLDGQG GRMLIRDTDR GTLDQDATYD RAIGPMQFIP TTWQEIGADA       360
     DSDGRKDPHD IDDAALAAAN YLCKGGRNLT VAGDWWNAIL SYNNVRQYAQ DVFDKANQYG       420
     QASRT                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page