(data stored in ACNUC7421 zone)

EMBL: CP000667.PE370

CP000667.PE370       Location/Qualifiers
FT   CDS             426119..427126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52855"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1V5"
FT                   /protein_id="ABP52855.1"
FT                   /translation="MRTVPPRRGSSPLTALAVAVAVAVLLGAVPAHAEPGEGGTEKLRN
FT                   ALTAAAKAHIDATAKLKNSKRRQGELATELKTVEARLTDLTAQVGEVAAQSYRLGRLTP
FT                   MATLLESTSPDEFLNRAMNLDVMAQRDGRKVRELTEGREAAKNAKIAIDSEVREQEKQL
FT                   DVLAKNKKAAEVALAAVSSGGGSGFGGGSASAASAPRNSDGSWPSESCSVNDPTTSGCI
FT                   SPRTLHMLKQSQADGFKRHVSCYRSGGGGEHPKGKACDFSAAPGGFENVSATGGDKTYG
FT                   DQLAAYLKNNASRLGVMYVIWYRQIWMPNTGWRSYNGGGSPAGDHTNHVHVSMY"
     MRTVPPRRGS SPLTALAVAV AVAVLLGAVP AHAEPGEGGT EKLRNALTAA AKAHIDATAK        60
     LKNSKRRQGE LATELKTVEA RLTDLTAQVG EVAAQSYRLG RLTPMATLLE STSPDEFLNR       120
     AMNLDVMAQR DGRKVRELTE GREAAKNAKI AIDSEVREQE KQLDVLAKNK KAAEVALAAV       180
     SSGGGSGFGG GSASAASAPR NSDGSWPSES CSVNDPTTSG CISPRTLHML KQSQADGFKR       240
     HVSCYRSGGG GEHPKGKACD FSAAPGGFEN VSATGGDKTY GDQLAAYLKN NASRLGVMYV       300
     IWYRQIWMPN TGWRSYNGGG SPAGDHTNHV HVSMY                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page