(data stored in ACNUC7421 zone)

EMBL: CP000667.PE375

CP000667.PE375       Location/Qualifiers
FT   CDS             complement(431740..432555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52860"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W0"
FT                   /protein_id="ABP52860.1"
FT                   /translation="MTQRIGANPLGRRVTVGPATFLAAGLLLTGCGVGGTEPPPSTPAD
FT                   PKDTLLAAVPNETTPAFRFSGTEVGGASVSGSVDPLLKAMELTFIQTDIETKAGGEFSM
FT                   TMSLRLIDERAWTKVSVGETAEMNEQLGLPRQWVELDQSKLSSIPEYDGADMGNAALII
FT                   RAADEVQQQADGSYTGTVDLTDESEVAEVVMNGDIAALGEQATSLPFTAVIGSDGNLDT
FT                   LSVDLPAVDEQPAAEYVVKYFDYGNAPAITPPAGDVAPAPDAVYEMLGE"
     MTQRIGANPL GRRVTVGPAT FLAAGLLLTG CGVGGTEPPP STPADPKDTL LAAVPNETTP        60
     AFRFSGTEVG GASVSGSVDP LLKAMELTFI QTDIETKAGG EFSMTMSLRL IDERAWTKVS       120
     VGETAEMNEQ LGLPRQWVEL DQSKLSSIPE YDGADMGNAA LIIRAADEVQ QQADGSYTGT       180
     VDLTDESEVA EVVMNGDIAA LGEQATSLPF TAVIGSDGNL DTLSVDLPAV DEQPAAEYVV       240
     KYFDYGNAPA ITPPAGDVAP APDAVYEMLG E                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page