(data stored in ACNUC7421 zone)

EMBL: CP000667.PE378

CP000667.PE378       Location/Qualifiers
FT   CDS             complement(435350..436555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52863"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W3"
FT                   /protein_id="ABP52863.1"
FT                   /translation="MPEPLPAALAEVRALLLDAGLNRAVAAGHRRGLRPAAHRAELRPV
FT                   TLKSGPRLQVITTDGSAPHTRNLARGAEAEAAVDALLAEPFGNWHVETAATTLQLRVTK
FT                   SGAAQVHRMAAPPVAEPVGHDRTKAHLLDPGDPIFTVIGGSAAKRRQVDAFLRALAATL
FT                   PDGLRGPLRVVDLGCGNAYLTFAAYRWLTQQDIDVHLVGVDVREDQRQRNTELARRLGW
FT                   ADQVRFVAGTIADAAVGPDPDLVLALHACDTATDEALARAVRWGSRWVLAAPCCHHDLA
FT                   AQLRSQPTPPPYELLTRQGILRERFADVLTDAVRAGLLRLHGYRAEVVEFVDSRHTPRN
FT                   LLIRARRAGAPPTGEHWAQYRTLVDGWRVTPRLATLLGEPAGGTATSATNGPADTTTDP
FT                   TD"
     MPEPLPAALA EVRALLLDAG LNRAVAAGHR RGLRPAAHRA ELRPVTLKSG PRLQVITTDG        60
     SAPHTRNLAR GAEAEAAVDA LLAEPFGNWH VETAATTLQL RVTKSGAAQV HRMAAPPVAE       120
     PVGHDRTKAH LLDPGDPIFT VIGGSAAKRR QVDAFLRALA ATLPDGLRGP LRVVDLGCGN       180
     AYLTFAAYRW LTQQDIDVHL VGVDVREDQR QRNTELARRL GWADQVRFVA GTIADAAVGP       240
     DPDLVLALHA CDTATDEALA RAVRWGSRWV LAAPCCHHDL AAQLRSQPTP PPYELLTRQG       300
     ILRERFADVL TDAVRAGLLR LHGYRAEVVE FVDSRHTPRN LLIRARRAGA PPTGEHWAQY       360
     RTLVDGWRVT PRLATLLGEP AGGTATSATN GPADTTTDPT D                           401
//

If you have problems or comments...

PBIL Back to PBIL home page