(data stored in ACNUC7421 zone)

EMBL: CP000667.PE379

CP000667.PE379       Location/Qualifiers
FT   CDS             complement(436657..438522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0379"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52864"
FT                   /db_xref="GOA:A4X1W4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W4"
FT                   /protein_id="ABP52864.1"
FT                   /translation="MGTDRRSISIWSQSIWSNDRLVPVSIWSQPAHDARAARSGSAIRC
FT                   PTVWPAPHRPRLEDSTGRTHERAPPIEMSELTHNLMDGTELAATAPVRPEAPTFAELGA
FT                   RKETVDALNAAGITRAFAIQEYALPIALRGVDLIGQAPTGTGKTLGFGVPLLERVFAPA
FT                   EGGDGTPQALVVVPTRELGIQVAKDLHAAGSTRGVRVLPIYGGVAYEPQIEALRTGVEI
FT                   LVGTPGRLLDLAKQKQLKLDRVRALVLDEADRMLDLGFLDDVEKILAMLPEERQTMLFS
FT                   ATMPDPIVALSRRFLRRPVTIHAGHTAETGPSPQTQQLAYRTHSLNKIEIVARILQAKG
FT                   RGLTMIFTRTKRAADRVAADLDFRGFAVAAVHGDLGQGARERALRAFRTGKIDTLVATD
FT                   VAARGIDVSGVTHVLNYDCPEDQDTYTHRIGRTGRAGASGVAVTFVDWDDMPRWRIIDK
FT                   TLGLEMPEPPETYHTSPHLYAELDIPSEVTGTLPTDARTRAGLSAEVEEDLGGGSRRGD
FT                   GRGPRRGTGRDRRRGRGGDASGGAGSSTTEPGEAGETAERTPRRRRRRRGGEVVTTGEP
FT                   AVVTVETGAAATTDSPGADAPKPRRRRRRRGGASGTGTAAKTTTD"
     MGTDRRSISI WSQSIWSNDR LVPVSIWSQP AHDARAARSG SAIRCPTVWP APHRPRLEDS        60
     TGRTHERAPP IEMSELTHNL MDGTELAATA PVRPEAPTFA ELGARKETVD ALNAAGITRA       120
     FAIQEYALPI ALRGVDLIGQ APTGTGKTLG FGVPLLERVF APAEGGDGTP QALVVVPTRE       180
     LGIQVAKDLH AAGSTRGVRV LPIYGGVAYE PQIEALRTGV EILVGTPGRL LDLAKQKQLK       240
     LDRVRALVLD EADRMLDLGF LDDVEKILAM LPEERQTMLF SATMPDPIVA LSRRFLRRPV       300
     TIHAGHTAET GPSPQTQQLA YRTHSLNKIE IVARILQAKG RGLTMIFTRT KRAADRVAAD       360
     LDFRGFAVAA VHGDLGQGAR ERALRAFRTG KIDTLVATDV AARGIDVSGV THVLNYDCPE       420
     DQDTYTHRIG RTGRAGASGV AVTFVDWDDM PRWRIIDKTL GLEMPEPPET YHTSPHLYAE       480
     LDIPSEVTGT LPTDARTRAG LSAEVEEDLG GGSRRGDGRG PRRGTGRDRR RGRGGDASGG       540
     AGSSTTEPGE AGETAERTPR RRRRRRGGEV VTTGEPAVVT VETGAAATTD SPGADAPKPR       600
     RRRRRRGGAS GTGTAAKTTT D                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page