(data stored in ACNUC7421 zone)

EMBL: CP000667.PE38

CP000667.PE38        Location/Qualifiers
FT   CDS             44651..44965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52523"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X3"
FT                   /protein_id="ABP52523.1"
FT                   /translation="MLTEVVSPDAEAGGRQDGSTPQRTAPPHPLPSLDSDPLTRPGLSA
FT                   EGWSSGPVDSLVDHPLLRGLLMELPPKGSVPPPGWLDRWFEATRAILELLYVQGSGRSR
FT                   "
     MLTEVVSPDA EAGGRQDGST PQRTAPPHPL PSLDSDPLTR PGLSAEGWSS GPVDSLVDHP        60
     LLRGLLMELP PKGSVPPPGW LDRWFEATRA ILELLYVQGS GRSR                        104
//

If you have problems or comments...

PBIL Back to PBIL home page