(data stored in ACNUC7421 zone)

EMBL: CP000667.PE382

CP000667.PE382       Location/Qualifiers
FT   CDS             439967..442186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52867"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W7"
FT                   /protein_id="ABP52867.1"
FT                   /translation="MSDAGQPGAASPGEHGDETGPQPVHSRSDSPWVPPTGGWAPEPST
FT                   PWRRSDSPVGWADSSPRHGDLPVPPPGATESGFHPQLNGYRVNGHPHPASGVPASRPSP
FT                   VSAPPGRPGEPAQEAGGDRATAPVSAAEQPPALAGGRSPEAGRDDWSDPPAEPGLTPAA
FT                   DRPTSPPEDWSGPSWGDEWASSQVSGESSPAGRRARMEPDGWDEPEPPGRRFRSGTARD
FT                   AAGKRRESSGRRFRPDPDATEAGEGRQPSTERPAWAVEPQRAYEPVRAEPASTFPIEPG
FT                   HRSGIRPKRQPGTEPAHQPSDPAAAWVPEQPAGSAEVDPPSATSARGGPGGWDRTPPEP
FT                   NPTSAPPHPARRSAPEPAATASLGDADRLPESVSAMLPQRVPAEPDVPVVPELPAAEAP
FT                   AKTPELARIATHLRQVDEPAPLRERPEGFDVDAILGAVRGVAGVRDAALRRTQSGAHSL
FT                   RLDLADGADPAEVSRHVARLLQERMGLAAAPQNMPEEPAGSVSSAPRRTDRPAHEEPAA
FT                   RAGRSPAGLPSRTERRNAALSEPPRRRRYSGGPHHGWATVDGPAVVSGAADGPATAETS
FT                   YGGGQITNTELAPSRPLDTGGRPGPRVVLDHVQVSTFGLDATVEVRLLSAGSPAAGYAT
FT                   GPAVDGYVLRLCATAAAAAVDELLRTPGSQPDRGRCFVEHATLVPLGNCEVATVVVLLV
FT                   CDGWVEQLAGSALVAGDPRQAMVRATLAAVNRRLEALLVDTGNAR"
     MSDAGQPGAA SPGEHGDETG PQPVHSRSDS PWVPPTGGWA PEPSTPWRRS DSPVGWADSS        60
     PRHGDLPVPP PGATESGFHP QLNGYRVNGH PHPASGVPAS RPSPVSAPPG RPGEPAQEAG       120
     GDRATAPVSA AEQPPALAGG RSPEAGRDDW SDPPAEPGLT PAADRPTSPP EDWSGPSWGD       180
     EWASSQVSGE SSPAGRRARM EPDGWDEPEP PGRRFRSGTA RDAAGKRRES SGRRFRPDPD       240
     ATEAGEGRQP STERPAWAVE PQRAYEPVRA EPASTFPIEP GHRSGIRPKR QPGTEPAHQP       300
     SDPAAAWVPE QPAGSAEVDP PSATSARGGP GGWDRTPPEP NPTSAPPHPA RRSAPEPAAT       360
     ASLGDADRLP ESVSAMLPQR VPAEPDVPVV PELPAAEAPA KTPELARIAT HLRQVDEPAP       420
     LRERPEGFDV DAILGAVRGV AGVRDAALRR TQSGAHSLRL DLADGADPAE VSRHVARLLQ       480
     ERMGLAAAPQ NMPEEPAGSV SSAPRRTDRP AHEEPAARAG RSPAGLPSRT ERRNAALSEP       540
     PRRRRYSGGP HHGWATVDGP AVVSGAADGP ATAETSYGGG QITNTELAPS RPLDTGGRPG       600
     PRVVLDHVQV STFGLDATVE VRLLSAGSPA AGYATGPAVD GYVLRLCATA AAAAVDELLR       660
     TPGSQPDRGR CFVEHATLVP LGNCEVATVV VLLVCDGWVE QLAGSALVAG DPRQAMVRAT       720
     LAAVNRRLEA LLVDTGNAR                                                    739
//

If you have problems or comments...

PBIL Back to PBIL home page