(data stored in ACNUC7421 zone)

EMBL: CP000667.PE384

CP000667.PE384       Location/Qualifiers
FT   CDS             443582..444454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52869"
FT                   /db_xref="GOA:A4X1W9"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W9"
FT                   /protein_id="ABP52869.1"
FT                   /translation="MEDSRERDRICPGSVTAVVDIDAAIGYVVARGDVVERARLGRLRT
FT                   GTPPAEEVLAVAEVGQLPEGGWPAYLEGETASVDATCFRLGELDDLGALGRSAARRALD
FT                   WLAARQLPEGGWEEDATLADTAPEWARPGAPEAGFYLTASAAFWLSVAGLDARAAGPLD
FT                   ARVGGAYAGVVHGAALSLAARLNPDGTWPSFLAAGWLSAAVLFRQEMYQESARIQVALA
FT                   ERIGDMAPANVAWLGATLRRVGVDPQDWVLVRARRRLAETQRSDGGWESEDGHQFDVHA
FT                   TLTAIRACH"
     MEDSRERDRI CPGSVTAVVD IDAAIGYVVA RGDVVERARL GRLRTGTPPA EEVLAVAEVG        60
     QLPEGGWPAY LEGETASVDA TCFRLGELDD LGALGRSAAR RALDWLAARQ LPEGGWEEDA       120
     TLADTAPEWA RPGAPEAGFY LTASAAFWLS VAGLDARAAG PLDARVGGAY AGVVHGAALS       180
     LAARLNPDGT WPSFLAAGWL SAAVLFRQEM YQESARIQVA LAERIGDMAP ANVAWLGATL       240
     RRVGVDPQDW VLVRARRRLA ETQRSDGGWE SEDGHQFDVH ATLTAIRACH                  290
//

If you have problems or comments...

PBIL Back to PBIL home page