(data stored in ACNUC7421 zone)

EMBL: CP000667.PE391

CP000667.PE391       Location/Qualifiers
FT   CDS             complement(451061..452107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0391"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52876"
FT                   /db_xref="GOA:A4X1X6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X6"
FT                   /protein_id="ABP52876.1"
FT                   /translation="MRAVTVSPRIPGSLCLVEDWPEPAVEEGGILVEALAVGVCGTDQD
FT                   IIAGHFGEAPPGQEQLVIGHESLGRVLEDPTGTLHRGDLVAAIVRHPDPVPCLNCAVDE
FT                   WDMCRNGLFTEHGIKGLPGFARERWRVQPRFAVPLGAAFARVGMLLEPTSIVAKAWEHI
FT                   ERVGHRARWDPRTTLITGAGPIGLLAALLATQRGLTVHVLDRNTTGPKPDLVRALGATY
FT                   HTESVNEVDLQPDVLVECTGDPRVVLDSMCKVGPTGIVCLTGMSTGGRTIDFDAGALNR
FT                   TLVLENTVVIGSVNSNRRHWEQAAAALARADHSWLDALITHRIPMSDFTTAYEVNDGTI
FT                   KVVLDLTA"
     MRAVTVSPRI PGSLCLVEDW PEPAVEEGGI LVEALAVGVC GTDQDIIAGH FGEAPPGQEQ        60
     LVIGHESLGR VLEDPTGTLH RGDLVAAIVR HPDPVPCLNC AVDEWDMCRN GLFTEHGIKG       120
     LPGFARERWR VQPRFAVPLG AAFARVGMLL EPTSIVAKAW EHIERVGHRA RWDPRTTLIT       180
     GAGPIGLLAA LLATQRGLTV HVLDRNTTGP KPDLVRALGA TYHTESVNEV DLQPDVLVEC       240
     TGDPRVVLDS MCKVGPTGIV CLTGMSTGGR TIDFDAGALN RTLVLENTVV IGSVNSNRRH       300
     WEQAAAALAR ADHSWLDALI THRIPMSDFT TAYEVNDGTI KVVLDLTA                    348
//

If you have problems or comments...

PBIL Back to PBIL home page