(data stored in ACNUC7421 zone)

EMBL: CP000667.PE396

CP000667.PE396       Location/Qualifiers
FT   CDS             complement(455942..457216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0396"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, dimerisation and
FT                   phosphoacceptor region"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52881"
FT                   /db_xref="GOA:A4X1Y1"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y1"
FT                   /protein_id="ABP52881.1"
FT                   /translation="MTSAAVSEHSWLLPGTLTAPTARARRTLRDWFVDSLCFLAAFGWA
FT                   VVAWDNSLSAEPAMAMNVGPSWLNEVDFLASLVLCGALWVRRRWPVGLALASLPLALFT
FT                   VSGDVALLIILFTVSVHRPFPVAASMFGVHLLAIPIYLWLRHDPVMSLWLTVGWILLCL
FT                   GAVLAWGMFVRARRQLVVSLRERAHRAEAEQQLRVTQARQLERTRIAREMHDVLAHRIS
FT                   LLSLHAGALEFRPDASPEEVARAAGVIRGSAHAALRDLREVIGVLRAETGVAEGAEPER
FT                   PQPTLVDVPTLISESRAAGVRVSFVEEVADQVELPPRVGRSVYRIVQEGLTNARKHAPG
FT                   VVVDVRLTGRQGDGLTVEIRNPWPVGVAGQGVGSPAARSGTDIPGAGTGLVGVAERVGL
FT                   AGGRLEYGRDAGGHFRLAAWLPWPA"
     MTSAAVSEHS WLLPGTLTAP TARARRTLRD WFVDSLCFLA AFGWAVVAWD NSLSAEPAMA        60
     MNVGPSWLNE VDFLASLVLC GALWVRRRWP VGLALASLPL ALFTVSGDVA LLIILFTVSV       120
     HRPFPVAASM FGVHLLAIPI YLWLRHDPVM SLWLTVGWIL LCLGAVLAWG MFVRARRQLV       180
     VSLRERAHRA EAEQQLRVTQ ARQLERTRIA REMHDVLAHR ISLLSLHAGA LEFRPDASPE       240
     EVARAAGVIR GSAHAALRDL REVIGVLRAE TGVAEGAEPE RPQPTLVDVP TLISESRAAG       300
     VRVSFVEEVA DQVELPPRVG RSVYRIVQEG LTNARKHAPG VVVDVRLTGR QGDGLTVEIR       360
     NPWPVGVAGQ GVGSPAARSG TDIPGAGTGL VGVAERVGLA GGRLEYGRDA GGHFRLAAWL       420
     PWPA                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page