(data stored in ACNUC7421 zone)

EMBL: CP000667.PE407

CP000667.PE407       Location/Qualifiers
FT   CDS             complement(468293..469051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0407"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52892"
FT                   /db_xref="GOA:A4X1Z2"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z2"
FT                   /protein_id="ABP52892.1"
FT                   /translation="MRVAGAQDAEFGHQDLSHRAVARLLVVLSASSGCLDVFCVTQLGG
FT                   FFASVITGNLVQLGHNLVAADSRLLIGGSVAVGGYAVGVAAGTLPLRHAGLGWRFRTHV
FT                   VTAAQVLILVGVAGGWWATGGRPDYPVSLALLFAAATASGIQSVVTISSGIPHAATTYL
FT                   TGSLTYIVRGMVFDPHRFAAGAAGANRLLGLLGGAVLGAVVLRVAPLWAPALAAALVAW
FT                   VLATAIAISRLHRRAHPPLTEGPASRGRNR"
     MRVAGAQDAE FGHQDLSHRA VARLLVVLSA SSGCLDVFCV TQLGGFFASV ITGNLVQLGH        60
     NLVAADSRLL IGGSVAVGGY AVGVAAGTLP LRHAGLGWRF RTHVVTAAQV LILVGVAGGW       120
     WATGGRPDYP VSLALLFAAA TASGIQSVVT ISSGIPHAAT TYLTGSLTYI VRGMVFDPHR       180
     FAAGAAGANR LLGLLGGAVL GAVVLRVAPL WAPALAAALV AWVLATAIAI SRLHRRAHPP       240
     LTEGPASRGR NR                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page