(data stored in ACNUC7421 zone)

EMBL: CP000667.PE410

CP000667.PE410       Location/Qualifiers
FT   CDS             complement(471193..471564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52895"
FT                   /db_xref="GOA:A4X1Z5"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z5"
FT                   /protein_id="ABP52895.1"
FT                   /translation="MTRVRHSGQQLRSGDHVGGGHMETWRFLAGVTMGVTMCLLGVALA
FT                   SNFRGMAERHVQQSMSFAGTLRRVPPWRWLPDASHDQRLARFILLERVFGVALAAVGFV
FT                   FLIGLAYSIAANQPMRMVK"
     MTRVRHSGQQ LRSGDHVGGG HMETWRFLAG VTMGVTMCLL GVALASNFRG MAERHVQQSM        60
     SFAGTLRRVP PWRWLPDASH DQRLARFILL ERVFGVALAA VGFVFLIGLA YSIAANQPMR       120
     MVK                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page