(data stored in ACNUC7421 zone)

EMBL: CP000667.PE412

CP000667.PE412       Location/Qualifiers
FT   CDS             complement(472643..473293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0412"
FT                   /product="Nucleoside phosphorylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52897"
FT                   /db_xref="GOA:A4X1Z7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z7"
FT                   /protein_id="ABP52897.1"
FT                   /translation="MTGVLVVTAVPAEAEAIRAGRGPTVTVAPVGVGPAVAGAATARLL
FT                   ALAEAAGRPYRLVVSAGVAGGFTGRVKVGGTVVGTSAVAADLGADSPTGFIPVDQLGMP
FT                   AELLGGGPTITADPTLVAALRAALPAAAAGPVLTVGTVTGTVAGTDALLRRHPDAVAEA
FT                   MEGYGVAVAAAHAGLPFVELRTISNPVGPRDRNAWRLREALTALTEAAAALPF"
     MTGVLVVTAV PAEAEAIRAG RGPTVTVAPV GVGPAVAGAA TARLLALAEA AGRPYRLVVS        60
     AGVAGGFTGR VKVGGTVVGT SAVAADLGAD SPTGFIPVDQ LGMPAELLGG GPTITADPTL       120
     VAALRAALPA AAAGPVLTVG TVTGTVAGTD ALLRRHPDAV AEAMEGYGVA VAAAHAGLPF       180
     VELRTISNPV GPRDRNAWRL REALTALTEA AAALPF                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page