(data stored in ACNUC7421 zone)

EMBL: CP000667.PE415

CP000667.PE415       Location/Qualifiers
FT   CDS             complement(475823..476068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52900"
FT                   /db_xref="GOA:A4X200"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:A4X200"
FT                   /protein_id="ABP52900.1"
FT                   /translation="MLKQPQPRPEPLDPPMVPFALAGMVGWAIAGVVLLFFRDQLVETG
FT                   REGWLWTCLAGFLWGLPGLAVMMRHDTHRRRRRAGH"
     MLKQPQPRPE PLDPPMVPFA LAGMVGWAIA GVVLLFFRDQ LVETGREGWL WTCLAGFLWG        60
     LPGLAVMMRH DTHRRRRRAG H                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page