(data stored in ACNUC7421 zone)

EMBL: CP000667.PE425

CP000667.PE425       Location/Qualifiers
FT   CDS             485351..486643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0425"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52910"
FT                   /db_xref="GOA:A4X210"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X210"
FT                   /protein_id="ABP52910.1"
FT                   /translation="MTEVRAARRQSSRWAIDLRPLAVPAFRRMWLGNTMAMLGFQLTAV
FT                   AVPVEMYALTGESFWVGLLGLAGFVPLLFFGLWGGAVADARDRRRVLLAGSALLWTTML
FT                   GLLAHASLGVGSPVLLLALVAVHSAGFAISSPARTAALPRLLPPGLVPAAATLNFTTFT
FT                   AASVVGPLAAGLIFAVTGTERGLPIAYAADALLFTGLVVAALRLPAMPPEPLGDGEVRR
FT                   GGLAGIRDGLRYLTTTPVLLLSFAIDLIAMVLALPRALFPEIAEERFGGGAAVGWLFSA
FT                   IAIGAMLAGLTSGWISRLRRQGLGLVVVVVGWGLAVAAAGLAQQLWLMVLLLAVAGAAD
FT                   LVSAVLRQSMLLVYAPDRMRGRLQGVNTVVVAGGPRLGDLRAGAMAGGFGSGVAWVGGG
FT                   LLSAVLALGLAVAFPALIRYRAAAVASEQRV"
     MTEVRAARRQ SSRWAIDLRP LAVPAFRRMW LGNTMAMLGF QLTAVAVPVE MYALTGESFW        60
     VGLLGLAGFV PLLFFGLWGG AVADARDRRR VLLAGSALLW TTMLGLLAHA SLGVGSPVLL       120
     LALVAVHSAG FAISSPARTA ALPRLLPPGL VPAAATLNFT TFTAASVVGP LAAGLIFAVT       180
     GTERGLPIAY AADALLFTGL VVAALRLPAM PPEPLGDGEV RRGGLAGIRD GLRYLTTTPV       240
     LLLSFAIDLI AMVLALPRAL FPEIAEERFG GGAAVGWLFS AIAIGAMLAG LTSGWISRLR       300
     RQGLGLVVVV VGWGLAVAAA GLAQQLWLMV LLLAVAGAAD LVSAVLRQSM LLVYAPDRMR       360
     GRLQGVNTVV VAGGPRLGDL RAGAMAGGFG SGVAWVGGGL LSAVLALGLA VAFPALIRYR       420
     AAAVASEQRV                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page