(data stored in ACNUC7421 zone)

EMBL: CP000667.PE428

CP000667.PE428       Location/Qualifiers
FT   CDS             488389..488694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52913"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:A4X213"
FT                   /protein_id="ABP52913.1"
FT                   /translation="MIFRAVRDGRPYPEHSLTLKQWAEIPPRPLRLDQLITTKRELALD
FT                   KLLAEDSTFYGDLFPHVVQWNGGLYLEDGLHRALRAALQQRNQIHARVFAFPAAVD"
     MIFRAVRDGR PYPEHSLTLK QWAEIPPRPL RLDQLITTKR ELALDKLLAE DSTFYGDLFP        60
     HVVQWNGGLY LEDGLHRALR AALQQRNQIH ARVFAFPAAV D                           101
//

If you have problems or comments...

PBIL Back to PBIL home page