(data stored in ACNUC7421 zone)

EMBL: CP000667.PE429

CP000667.PE429       Location/Qualifiers
FT   CDS             488729..489889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0429"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52914"
FT                   /db_xref="GOA:A4X214"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X214"
FT                   /protein_id="ABP52914.1"
FT                   /translation="MSPLDLLDVDSSLSAEERQIRAVVRQLVDEQVRPHVAGWYEEGRV
FT                   PARELAREFGRLGLLGMHLTGYGCAGSSAVAYGLACLELEAGDSGVRSLVSVQGALAMY
FT                   AIWRYGSTEQKQHWLPAMAAGETIGCFALTEPDHGSDPASMTTRARRDGDDWVLHGTKM
FT                   WITNATIADVAVIWARTDEGVRGFAVPTSTPGVAVREIRRKMSLRASVTGEISLDDVRL
FT                   PAAARLPDAVGLKAPLGCLTEARHGIVWGALGAARDCLETTLEYAGSRTQFGRPLAGFQ
FT                   LTQAKLADMAVEWSKGYLLALQLGRLADAHRLRPDQVSVGKLNNVREALAIARQCRTIL
FT                   GANGVSGEYPVLRHANNLESVLTYEGTSEIHQLVIGQRLTGLSAFA"
     MSPLDLLDVD SSLSAEERQI RAVVRQLVDE QVRPHVAGWY EEGRVPAREL AREFGRLGLL        60
     GMHLTGYGCA GSSAVAYGLA CLELEAGDSG VRSLVSVQGA LAMYAIWRYG STEQKQHWLP       120
     AMAAGETIGC FALTEPDHGS DPASMTTRAR RDGDDWVLHG TKMWITNATI ADVAVIWART       180
     DEGVRGFAVP TSTPGVAVRE IRRKMSLRAS VTGEISLDDV RLPAAARLPD AVGLKAPLGC       240
     LTEARHGIVW GALGAARDCL ETTLEYAGSR TQFGRPLAGF QLTQAKLADM AVEWSKGYLL       300
     ALQLGRLADA HRLRPDQVSV GKLNNVREAL AIARQCRTIL GANGVSGEYP VLRHANNLES       360
     VLTYEGTSEI HQLVIGQRLT GLSAFA                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page