(data stored in ACNUC7421 zone)

EMBL: CP000667.PE436

CP000667.PE436       Location/Qualifiers
FT   CDS             498862..499293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52921"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X221"
FT                   /protein_id="ABP52921.1"
FT                   /translation="MLAAVPFARTLGFEFVKVAPEADGAIQAVVRLPDTSATHNHVGGP
FT                   HAGAMFTLGETASGAVVVAAFAPVLDRATPLAVSAEIAYRKLAMGPVRATARLDRPAAD
FT                   VVAELDAGERPEFPVRVEIATEEGKPTGEMTVVWTLRPH"
     MLAAVPFART LGFEFVKVAP EADGAIQAVV RLPDTSATHN HVGGPHAGAM FTLGETASGA        60
     VVVAAFAPVL DRATPLAVSA EIAYRKLAMG PVRATARLDR PAADVVAELD AGERPEFPVR       120
     VEIATEEGKP TGEMTVVWTL RPH                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page