(data stored in ACNUC7421 zone)

EMBL: CP000667.PE438

CP000667.PE438       Location/Qualifiers
FT   CDS             500104..502479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0438"
FT                   /product="Kojibiose phosphorylase"
FT                   /EC_number="2.4.1.230"
FT                   /note="PFAM: glycoside hydrolase, family 65 domain protein;
FT                   glycoside hydrolase family 65, central catalytic; glycoside
FT                   hydrolase family 65 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52923"
FT                   /db_xref="GOA:A4X223"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A4X223"
FT                   /protein_id="ABP52923.1"
FT                   /translation="MIRERAYPVEPWHVRETTLDMDVLAQSESVFALSNGHIGLRGNLD
FT                   EGEPYGLPGTYLNSFYELRPLPHAEAGFGFPESGQTIVNVTNGKLIRLLVDDEPLDVRY
FT                   GELLAHERVLDLRGGTLHRTVHWRSPAGREVCVRSTRLVSFRQRSAAAINYEVEVVDGK
FT                   PLRLIVQSELVANETLPAQSKDPRVAAVLESPLLAEEELTTHDGGLLIHRTKVSGLRLA
FT                   AAMEHEVHTTARTNLESEGYEDWVRTTTACVLKPGETLRVVKYLSYGWSSRRSLPALRD
FT                   QVGAALAAAKLDGWDGLLREQREYLDEFWDSADVLVEGDPEVQQAVRFGLFHVLQAGTR
FT                   AERRPISAKGLTGPGYDGHAFWDTEMFVLPVLTYTHPTAVRDALYWRHHTLPAAQDRAR
FT                   TLNLAGAAFPWRTIEGPESSGYWPAGTAGFHIAADIADAVRRYVHATQDTDLEREIGLE
FT                   LLVETARLWRSLGHHDRHGQFHIDGVTGPDEYTAIKNDNIYTNLMAQRNLTTAAETVMR
FT                   YRDEAAHLGVTDEEAASWRDAAADIHIPYDQEIDVHEQVEGFTRFQEWDFVHTPPEKYP
FT                   LLLHYPYFDLYRKQVIKQADLVLAMHWRGDAFTPEQKLRNFLYYERRTVRDSSLSACTQ
FT                   AVLAAEVGYSELAHTYLREAALMDLHDLNENTRDGVHIAALAGSWIALVAGFGGLRDHD
FT                   GTLCFTPRLSSRLGRLEFSLHWRRIQLRVDIQPHQTTYTLQHSDPEEALEFLHHGERIR
FT                   VTAAEPVTRPTPPAEEPSRAPEQPPGRDPLIRLPEREP"
     MIRERAYPVE PWHVRETTLD MDVLAQSESV FALSNGHIGL RGNLDEGEPY GLPGTYLNSF        60
     YELRPLPHAE AGFGFPESGQ TIVNVTNGKL IRLLVDDEPL DVRYGELLAH ERVLDLRGGT       120
     LHRTVHWRSP AGREVCVRST RLVSFRQRSA AAINYEVEVV DGKPLRLIVQ SELVANETLP       180
     AQSKDPRVAA VLESPLLAEE ELTTHDGGLL IHRTKVSGLR LAAAMEHEVH TTARTNLESE       240
     GYEDWVRTTT ACVLKPGETL RVVKYLSYGW SSRRSLPALR DQVGAALAAA KLDGWDGLLR       300
     EQREYLDEFW DSADVLVEGD PEVQQAVRFG LFHVLQAGTR AERRPISAKG LTGPGYDGHA       360
     FWDTEMFVLP VLTYTHPTAV RDALYWRHHT LPAAQDRART LNLAGAAFPW RTIEGPESSG       420
     YWPAGTAGFH IAADIADAVR RYVHATQDTD LEREIGLELL VETARLWRSL GHHDRHGQFH       480
     IDGVTGPDEY TAIKNDNIYT NLMAQRNLTT AAETVMRYRD EAAHLGVTDE EAASWRDAAA       540
     DIHIPYDQEI DVHEQVEGFT RFQEWDFVHT PPEKYPLLLH YPYFDLYRKQ VIKQADLVLA       600
     MHWRGDAFTP EQKLRNFLYY ERRTVRDSSL SACTQAVLAA EVGYSELAHT YLREAALMDL       660
     HDLNENTRDG VHIAALAGSW IALVAGFGGL RDHDGTLCFT PRLSSRLGRL EFSLHWRRIQ       720
     LRVDIQPHQT TYTLQHSDPE EALEFLHHGE RIRVTAAEPV TRPTPPAEEP SRAPEQPPGR       780
     DPLIRLPERE P                                                            791
//

If you have problems or comments...

PBIL Back to PBIL home page