(data stored in ACNUC7421 zone)

EMBL: CP000667.PE44

CP000667.PE44        Location/Qualifiers
FT   CDS             50427..51875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0044"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="PFAM: protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52529"
FT                   /db_xref="GOA:A4X0X9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X9"
FT                   /protein_id="ABP52529.1"
FT                   /translation="MTLTLRYAAHSDRGLIRDGNQDSVYAGPRLLAVADGMGGMAAGDV
FT                   ASNIVIGAMAPLDEDVPGNALVDALRSAVTNATQQLRETVDANPQLEGMGTTLTAILFS
FT                   GSKLGMVHIGDSRAYLLRASEFAQITKDDTYVQMLVDEGRISAEEASSHPQRSLLTRAL
FT                   DGRDIDAEYSVRQVLTGDRYLICSDGLSGVVSAETIAETMREYADPQQCVERLVQLALR
FT                   GGGPDNITVIIADATDQDIVEATPIVGGAASRDRGMATSADDSTPAARASALSGSPPVT
FT                   PDESTAAADEEPERRRRRPIRLVATSLALIVLLGGALYGGWSYTQRQYYVGATGGGQVA
FT                   VFRGIEGEIAGIDLSAVHSTSSAELDDLTLAAQERVKQGIPAESEADAERRLAELTADT
FT                   PTNPNLKPTCPPSPSPSPSPPVVPSPTAEPGAPTPTTEPSAPPSISATSSTPATGLPTE
FT                   PTLSPDALPAIPPAVDPAACRSPE"
     MTLTLRYAAH SDRGLIRDGN QDSVYAGPRL LAVADGMGGM AAGDVASNIV IGAMAPLDED        60
     VPGNALVDAL RSAVTNATQQ LRETVDANPQ LEGMGTTLTA ILFSGSKLGM VHIGDSRAYL       120
     LRASEFAQIT KDDTYVQMLV DEGRISAEEA SSHPQRSLLT RALDGRDIDA EYSVRQVLTG       180
     DRYLICSDGL SGVVSAETIA ETMREYADPQ QCVERLVQLA LRGGGPDNIT VIIADATDQD       240
     IVEATPIVGG AASRDRGMAT SADDSTPAAR ASALSGSPPV TPDESTAAAD EEPERRRRRP       300
     IRLVATSLAL IVLLGGALYG GWSYTQRQYY VGATGGGQVA VFRGIEGEIA GIDLSAVHST       360
     SSAELDDLTL AAQERVKQGI PAESEADAER RLAELTADTP TNPNLKPTCP PSPSPSPSPP       420
     VVPSPTAEPG APTPTTEPSA PPSISATSST PATGLPTEPT LSPDALPAIP PAVDPAACRS       480
     PE                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page