(data stored in ACNUC7421 zone)

EMBL: CP000667.PE445

CP000667.PE445       Location/Qualifiers
FT   CDS             complement(508593..508904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0445"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52930"
FT                   /db_xref="GOA:A4X230"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X230"
FT                   /protein_id="ABP52930.1"
FT                   /translation="MVRMTRPEPAPVRGYTATKDQLLTRLRRVEGQVRGIEKMVEEDRY
FT                   CIDVLTQIAAIQAALDKVALGLLDGHARHCMREGAAEGRADEMATEMMAAVGRLMKRG"
     MVRMTRPEPA PVRGYTATKD QLLTRLRRVE GQVRGIEKMV EEDRYCIDVL TQIAAIQAAL        60
     DKVALGLLDG HARHCMREGA AEGRADEMAT EMMAAVGRLM KRG                         103
//

If you have problems or comments...

PBIL Back to PBIL home page