(data stored in ACNUC7421 zone)

EMBL: CP000667.PE446

CP000667.PE446       Location/Qualifiers
FT   CDS             508999..509235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0446"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52931"
FT                   /db_xref="GOA:A4X231"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4X231"
FT                   /protein_id="ABP52931.1"
FT                   /translation="MVTTTYQVRGMTCGHCVNAVSAEVGGLTGVEKVQVDLEAGRLTVT
FT                   SQHPMEIEAVRAAVDEAGYDLVDAAPTSRPRPA"
     MVTTTYQVRG MTCGHCVNAV SAEVGGLTGV EKVQVDLEAG RLTVTSQHPM EIEAVRAAVD        60
     EAGYDLVDAA PTSRPRPA                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page