(data stored in ACNUC7421 zone)

EMBL: CP000667.PE447

CP000667.PE447       Location/Qualifiers
FT   CDS             509232..509441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52932"
FT                   /db_xref="UniProtKB/TrEMBL:A4X232"
FT                   /protein_id="ABP52932.1"
FT                   /translation="MRTATKLTAFLLGLVAVFGAAYGVGQVTGPVTPAVETHHDDPERS
FT                   NPEHDNPGAGSNLPGHGPDRQGAR"
     MRTATKLTAF LLGLVAVFGA AYGVGQVTGP VTPAVETHHD DPERSNPEHD NPGAGSNLPG        60
     HGPDRQGAR                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page