(data stored in ACNUC7421 zone)

EMBL: CP000667.PE448

CP000667.PE448       Location/Qualifiers
FT   CDS             509438..511729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0448"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52933"
FT                   /db_xref="GOA:A4X233"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4X233"
FT                   /protein_id="ABP52933.1"
FT                   /translation="MTTTSSPKPRAVNQIELSIGGMTCASCAARIEKKLNRMPGVTATV
FT                   NYATEKARVAYADGVTSDDLIATVEKTGYTAVVPPPPAATAAPVAEPADESRGLGTRLW
FT                   VSAVLTVPVILLAMVPPWQFTYWQWLSLTLAAPVVVWGGLPFHRAAWVNLRHGAATMDT
FT                   LVSLGTLAAFGWSLWALFLGTAGVAGMTHPFSFAIVRGTGAGNIYLEAAAGVTTFILAG
FT                   RYFEARAKRTAGAALRTLLELGAKEVAVLRGDVETRIPIDQLVVGDRFVVRPGEKVATD
FT                   GMVVEGSSAVDASMLTGEAVPVEVKAGDAVVGATVNAGGRLVVAATRVGGDTQLAQMAR
FT                   LVEAAQSGKAAVQRLADRVSGVFVPVVITLAAGTLGWWLGSGAGPTAAFTAAVAVLIIA
FT                   CPCALGLATPTALLVGTGRGAQLGILIKGPEVLESTRTVDTVVLDKTGTVTTGRMTLVD
FT                   VVAASGVERAELLRLAGALEAASEHPIAQAVAVGAAEAGPLPPVADFANLEGLGVEGVV
FT                   DGHRVLVGRPRLLRERGLHVPEEMVTAGATAQAAGATAVLVAWDGRARGLLAVADVVRP
FT                   TSALALRQLRELGLDPVLLTGDNETVARAVAAEVGIDEVVAEVLPAEKVAVVQRLQREG
FT                   RVVAMVGDGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLTAAVDAIRLSRRTL
FT                   AIIKGNLFWAFAYNVAALPLAAAGLLNPMIAGAAMAFSSVFVVVNSLRLRGFRPLAPVT
FT                   QGLRSTGHPR"
     MTTTSSPKPR AVNQIELSIG GMTCASCAAR IEKKLNRMPG VTATVNYATE KARVAYADGV        60
     TSDDLIATVE KTGYTAVVPP PPAATAAPVA EPADESRGLG TRLWVSAVLT VPVILLAMVP       120
     PWQFTYWQWL SLTLAAPVVV WGGLPFHRAA WVNLRHGAAT MDTLVSLGTL AAFGWSLWAL       180
     FLGTAGVAGM THPFSFAIVR GTGAGNIYLE AAAGVTTFIL AGRYFEARAK RTAGAALRTL       240
     LELGAKEVAV LRGDVETRIP IDQLVVGDRF VVRPGEKVAT DGMVVEGSSA VDASMLTGEA       300
     VPVEVKAGDA VVGATVNAGG RLVVAATRVG GDTQLAQMAR LVEAAQSGKA AVQRLADRVS       360
     GVFVPVVITL AAGTLGWWLG SGAGPTAAFT AAVAVLIIAC PCALGLATPT ALLVGTGRGA       420
     QLGILIKGPE VLESTRTVDT VVLDKTGTVT TGRMTLVDVV AASGVERAEL LRLAGALEAA       480
     SEHPIAQAVA VGAAEAGPLP PVADFANLEG LGVEGVVDGH RVLVGRPRLL RERGLHVPEE       540
     MVTAGATAQA AGATAVLVAW DGRARGLLAV ADVVRPTSAL ALRQLRELGL DPVLLTGDNE       600
     TVARAVAAEV GIDEVVAEVL PAEKVAVVQR LQREGRVVAM VGDGVNDAAA LAQADLGLAM       660
     GTGTDVAIEA SDLTLVRGDL TAAVDAIRLS RRTLAIIKGN LFWAFAYNVA ALPLAAAGLL       720
     NPMIAGAAMA FSSVFVVVNS LRLRGFRPLA PVTQGLRSTG HPR                         763
//

If you have problems or comments...

PBIL Back to PBIL home page