(data stored in ACNUC7421 zone)

EMBL: CP000667.PE45

CP000667.PE45        Location/Qualifiers
FT   CDS             51904..53394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0045"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52530"
FT                   /db_xref="GOA:A4X0Y0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y0"
FT                   /protein_id="ABP52530.1"
FT                   /translation="MTVAATSTSPPTNTGGQSGVRLARSRRNAELSLLLLAMVLVAAYG
FT                   AMVEASVLDTVTPSFWIPAAALTAVFLGLHVAIRFLAPFADPALLPAVALLNGLGVGFL
FT                   HRLDLARATPAERAELATFAGTGGRQLAWTLISVALAAGLLAIVRDHRSISRYAYTLGL
FT                   AGIVLVMIPAVLPRSISEINGAKLWIRVGGLSIQPGEFAKLALLAFFAYYLVRKREVLS
FT                   LASRRILGVDLPRGRDLGPVVVVWLISLLVLVFEKDLGTSLLYFGMFVATLYIATERVS
FT                   WLLIGLVLFFGGAYLAYVLGDAIGGPFANFYLRANIWLDPFADPYNDGYQLVQGLLALG
FT                   SGGMFGAGPGAGQPLKLPEVQNDFIFAGLGEEIGLFGLSALLVVYLLIVERGLRAALAV
FT                   HDSFGKLLAGGLAFTLGLQVFVIVGGISGLIPLTGQTTPFLSAGGSSLMANWLLIAILL
FT                   RVSDAARRPVTSGGPPSPRSTGGPPEQLHGAPTEVIRP"
     MTVAATSTSP PTNTGGQSGV RLARSRRNAE LSLLLLAMVL VAAYGAMVEA SVLDTVTPSF        60
     WIPAAALTAV FLGLHVAIRF LAPFADPALL PAVALLNGLG VGFLHRLDLA RATPAERAEL       120
     ATFAGTGGRQ LAWTLISVAL AAGLLAIVRD HRSISRYAYT LGLAGIVLVM IPAVLPRSIS       180
     EINGAKLWIR VGGLSIQPGE FAKLALLAFF AYYLVRKREV LSLASRRILG VDLPRGRDLG       240
     PVVVVWLISL LVLVFEKDLG TSLLYFGMFV ATLYIATERV SWLLIGLVLF FGGAYLAYVL       300
     GDAIGGPFAN FYLRANIWLD PFADPYNDGY QLVQGLLALG SGGMFGAGPG AGQPLKLPEV       360
     QNDFIFAGLG EEIGLFGLSA LLVVYLLIVE RGLRAALAVH DSFGKLLAGG LAFTLGLQVF       420
     VIVGGISGLI PLTGQTTPFL SAGGSSLMAN WLLIAILLRV SDAARRPVTS GGPPSPRSTG       480
     GPPEQLHGAP TEVIRP                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page