(data stored in ACNUC7421 zone)

EMBL: CP000667.PE451

CP000667.PE451       Location/Qualifiers
FT   CDS             complement(514356..515057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0451"
FT                   /product="Spermidine synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52936"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X236"
FT                   /protein_id="ABP52936.1"
FT                   /translation="MHDFRQPPITLDRVTTSRGELVLRETNGRYEVISNGVFLMDTADG
FT                   RSERLLVDAAVSRCTGPAPRLLIGGLGVGFSLLRAVEHPHVAAIDVVEIEATVIGWHAR
FT                   HLRPLTGAAQADPRVRIVEADILAWLADTADQYDAICLDTDNGPNWLVFEANAELYAHR
FT                   GLDLVAGRLRPGGVLAIWSASRDDAFEQRLRERFGDLELLETPTDAGAPDVVYLVRAAT
FT                   AAPGELPESPA"
     MHDFRQPPIT LDRVTTSRGE LVLRETNGRY EVISNGVFLM DTADGRSERL LVDAAVSRCT        60
     GPAPRLLIGG LGVGFSLLRA VEHPHVAAID VVEIEATVIG WHARHLRPLT GAAQADPRVR       120
     IVEADILAWL ADTADQYDAI CLDTDNGPNW LVFEANAELY AHRGLDLVAG RLRPGGVLAI       180
     WSASRDDAFE QRLRERFGDL ELLETPTDAG APDVVYLVRA ATAAPGELPE SPA              233
//

If you have problems or comments...

PBIL Back to PBIL home page