(data stored in ACNUC7421 zone)

EMBL: CP000667.PE455

CP000667.PE455       Location/Qualifiers
FT   CDS             517241..518512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52940"
FT                   /db_xref="GOA:A4X240"
FT                   /db_xref="UniProtKB/TrEMBL:A4X240"
FT                   /protein_id="ABP52940.1"
FT                   /translation="MRRALWVELRRGTAPYAALAMFGAGVWVLAAHPDDWAGRWVGLAD
FT                   YLRVSLLALCPLMVSAGAWQAGRERRRDIGELVAATPRPGWHSLVAAWLAVTLAGIAGL
FT                   VVAFAGAAVLVARVATYGGGDWWQRAAVGVLALAAASAGGVLVGRRVPLRVAAPIAGLA
FT                   TYLGLAILTYWNAAPARLSPAYGGRWMYSLVPEWVTGLQVTWLVALTALLLAVAVRRGR
FT                   VALLAGAVAVAAAVPISTAPSWNRAPADPAAVELVCTTSGPEVCLTRVNAFLLDEVAAV
FT                   AQPILARLDGIPGAPRQAVDQTVRPAGASVVEDADTVWLDLDFQATPLGGLANVDYLRS
FT                   AFRQMAGVECAYSSAVDQRDQRIHQADNMATDWLLDGTVFGVGGASAGLRELPPSAQRT
FT                   WFADYLDAAGRCDLPALVRLAEQP"
     MRRALWVELR RGTAPYAALA MFGAGVWVLA AHPDDWAGRW VGLADYLRVS LLALCPLMVS        60
     AGAWQAGRER RRDIGELVAA TPRPGWHSLV AAWLAVTLAG IAGLVVAFAG AAVLVARVAT       120
     YGGGDWWQRA AVGVLALAAA SAGGVLVGRR VPLRVAAPIA GLATYLGLAI LTYWNAAPAR       180
     LSPAYGGRWM YSLVPEWVTG LQVTWLVALT ALLLAVAVRR GRVALLAGAV AVAAAVPIST       240
     APSWNRAPAD PAAVELVCTT SGPEVCLTRV NAFLLDEVAA VAQPILARLD GIPGAPRQAV       300
     DQTVRPAGAS VVEDADTVWL DLDFQATPLG GLANVDYLRS AFRQMAGVEC AYSSAVDQRD       360
     QRIHQADNMA TDWLLDGTVF GVGGASAGLR ELPPSAQRTW FADYLDAAGR CDLPALVRLA       420
     EQP                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page